PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G024000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 341aa    MW: 36978.3 Da    PI: 4.6661
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G024000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.3e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +grWT+eEde+l +++k++G g+W++ ++  g+ R++k+c++rw +yl
  Sevir.5G024000.1.p 14 KGRWTKEEDEILGRYIKEHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                        79******************************99************97 PP

2Myb_DNA-binding54.33e-1767112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+ ++eE+e ++++++ lG++ W++Ia +++ gRt++++k++w+++l
  Sevir.5G024000.1.p  67 RGNISEEEEEMIIKLHATLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112
                         7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-22564IPR009057Homeodomain-like
PROSITE profilePS5129418.099961IPR017930Myb domain
SuperFamilySSF466895.99E-2911108IPR009057Homeodomain-like
SMARTSM007173.0E-121363IPR001005SANT/Myb domain
PfamPF002497.3E-151461IPR001005SANT/Myb domain
CDDcd001672.49E-111661No hitNo description
PROSITE profilePS5129425.32362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2565115IPR009057Homeodomain-like
SMARTSM007174.4E-1766114IPR001005SANT/Myb domain
PfamPF002492.0E-1567112IPR001005SANT/Myb domain
CDDcd001675.25E-977112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTKE EDEILGRYIK EHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SEEEEEMIIK LHATLGNRWS LIAGHLPGRT DNEIKNYWNS HLSRRAADFR  120
DGVVVNVDLS KLPGGGKRRG GRASRGIMAA AKAGKEKKVK EKEKDKGKNK AAEAEQQLKL  180
EEEDMAVSTP SSHSQPCATD KSGEEQAQAS ASGVTSDDGP EEDPLALSEE MMSALLGPVS  240
PKLEVGPDGS GMDSDSGPSS LVVDSESGPG GPTGDVAQEL GENDKAIMDW DLMGLDISTA  300
GDMWDPLVWD YADMDIVVPD GGHQQQQEDV VSDLFFLDNM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794110.0HF679411.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB5 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967542.10.0PREDICTED: myb-related protein P-like
TrEMBLK3XJN40.0K3XJN4_SETIT; Uncharacterized protein
STRINGSi002107m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.14e-71myb domain protein 12